DOK6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104930
Article Name: DOK6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104930
Supplier Catalog Number: orb2104930
Alternative Catalog Number: BYT-ORB2104930-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DOK6
Conjugation: Biotin
Alternative Names: DOK5L, HsT3226
DOK6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38
NCBI: 689934
UniProt: Q6PKX4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI