GABARAPL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105110
Article Name: GABARAPL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105110
Supplier Catalog Number: orb2105110
Alternative Catalog Number: BYT-ORB2105110-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABARAPL1
Conjugation: Biotin
Alternative Names: ATG8, GEC1, APG8L, ATG8B, ATG8L, APG8-LIKE
GABARAPL1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 113600
UniProt: Q9H0R8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL