RGD1561459 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105119
Article Name: RGD1561459 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105119
Supplier Catalog Number: orb2105119
Alternative Catalog Number: BYT-ORB2105119-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1561459
Conjugation: Biotin
Alternative Names: RGD1561459
RGD1561459 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 001101963
UniProt: D3ZZQ4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK