MTBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105125
Article Name: MTBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105125
Supplier Catalog Number: orb2105125
Alternative Catalog Number: BYT-ORB2105125-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTBP
Conjugation: Biotin
Alternative Names: MDM2BP
MTBP Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 071328
UniProt: B4DUR5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG