COPG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105194
Article Name: COPG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105194
Supplier Catalog Number: orb2105194
Alternative Catalog Number: BYT-ORB2105194-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPG
Conjugation: Biotin
Alternative Names: COPG
COPG Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 98kDa
NCBI: 057212
UniProt: Q9Y678
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK