C2orf25 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105206
Article Name: C2orf25 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105206
Supplier Catalog Number: orb2105206
Alternative Catalog Number: BYT-ORB2105206-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf25
Conjugation: Biotin
Alternative Names: cblD, C2orf25, CL25022
C2orf25 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 056517
UniProt: Q9H3L0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL