Irf2bp1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105242
Article Name: Irf2bp1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105242
Supplier Catalog Number: orb2105242
Alternative Catalog Number: BYT-ORB2105242-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Conjugation: Biotin
Alternative Names: Irf2bp1
Irf2bp1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 001100953
UniProt: D4AAZ8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK