ARHGEF26 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105278
Article Name: ARHGEF26 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105278
Supplier Catalog Number: orb2105278
Alternative Catalog Number: BYT-ORB2105278-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGEF
Conjugation: Biotin
Alternative Names: SGEF, CSGEF, HMFN1864
ARHGEF26 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 97kDa
NCBI: 056410
UniProt: Q96DR7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD