Poc1a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2105353
| Article Name: |
Poc1a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2105353 |
| Supplier Catalog Number: |
orb2105353 |
| Alternative Catalog Number: |
BYT-ORB2105353-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Poc1a |
| Conjugation: |
Biotin |
| Alternative Names: |
Wdr51a, RGD1565004 |
| Poc1a Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
40kDa |
| NCBI: |
001102766 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD |
