KIAA0930 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105389
Article Name: KIAA0930 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105389
Supplier Catalog Number: orb2105389
Alternative Catalog Number: BYT-ORB2105389-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-KIAA0930 antibody is: synthetic peptide directed towards the C-terminal region of Human K0930
Conjugation: Biotin
Alternative Names: LSC3, C22orf9
KIAA0930 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 40 kDa
UniProt: Q6ICG6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSRSLSG