TBC1D1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105425
Article Name: TBC1D1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105425
Supplier Catalog Number: orb2105425
Alternative Catalog Number: BYT-ORB2105425-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D1
Conjugation: Biotin
Alternative Names: TBC, TBC1
TBC1D1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 133kDa
NCBI: 055988
UniProt: Q86TI0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW