KIFAP3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105488
Article Name: KIFAP3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105488
Supplier Catalog Number: orb2105488
Alternative Catalog Number: BYT-ORB2105488-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIFAP3
Conjugation: Biotin
Alternative Names: FLA3, KAP3, SMAP, KAP-1, KAP-3, Smg-GDS, dJ190I16.1
KIFAP3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 91kDa
NCBI: 055785
UniProt: Q92845
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG