PRDX5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2106016
| Article Name: |
PRDX5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2106016 |
| Supplier Catalog Number: |
orb2106016 |
| Alternative Catalog Number: |
BYT-ORB2106016-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human PRDX5 |
| Conjugation: |
Biotin |
| Alternative Names: |
PLP, ACR1, B166, PRXV, PMP20, PRDX6, prx-V, SBBI10, AOEB166, HEL-S-55 |
| PRDX5 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
14kDa |
| NCBI: |
857635 |
| UniProt: |
B7ZVW3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI |
