DNAJB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106091
Article Name: DNAJB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106091
Supplier Catalog Number: orb2106091
Alternative Catalog Number: BYT-ORB2106091-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB1
Conjugation: Biotin
Alternative Names: Hdj1, Sis1, HSPF1, Hsp40, RSPH16B
DNAJB1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 006136
UniProt: P25685
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE