KIF5C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106196
Article Name: KIF5C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106196
Supplier Catalog Number: orb2106196
Alternative Catalog Number: BYT-ORB2106196-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5C
Conjugation: Biotin
Alternative Names: KINN, NKHC, NKHC2, CDCBM2, NKHC-2
KIF5C Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 109kDa
NCBI: 004513
UniProt: O60282
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDR