LYN Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106261
Article Name: LYN Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106261
Supplier Catalog Number: orb2106261
Alternative Catalog Number: BYT-ORB2106261-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYN
Conjugation: FITC
Alternative Names: JTK8, p53Lyn, p56Lyn
LYN Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 002341
UniProt: P07948
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF