FES Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106399
Article Name: FES Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106399
Supplier Catalog Number: orb2106399
Alternative Catalog Number: BYT-ORB2106399-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FES
Conjugation: FITC
Alternative Names: FPS
FES Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 001996
UniProt: P07332
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQL