FAU Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2106411
| Article Name: |
FAU Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2106411 |
| Supplier Catalog Number: |
orb2106411 |
| Alternative Catalog Number: |
BYT-ORB2106411-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human FAU |
| Conjugation: |
FITC |
| Alternative Names: |
S30, FAU1, Fub1, Fubi, asr1, RPS30, MNSFbeta |
| FAU Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
14kDa |
| NCBI: |
001988 |
| UniProt: |
P62861 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS |
