ARF6 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106417
Article Name: ARF6 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106417
Supplier Catalog Number: orb2106417
Alternative Catalog Number: BYT-ORB2106417-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARF6
Conjugation: FITC
Alternative Names: DKFZp564M0264
ARF6 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 001654
UniProt: P62330
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG