ARCN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106420
Article Name: ARCN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106420
Supplier Catalog Number: orb2106420
Alternative Catalog Number: BYT-ORB2106420-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARCN1
Conjugation: FITC
Alternative Names: COPD, SRMMD
ARCN1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 001646
UniProt: P48444
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT