ARAF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2106422
Article Name: ARAF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106422
Supplier Catalog Number: orb2106422
Alternative Catalog Number: BYT-ORB2106422-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARAF
Conjugation: HRP
Alternative Names: PKS2, A-RAF, ARAF1, RAFA1
ARAF Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 001645
UniProt: P10398
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW