ARAF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106424
Article Name: ARAF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106424
Supplier Catalog Number: orb2106424
Alternative Catalog Number: BYT-ORB2106424-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARAF
Conjugation: Biotin
Alternative Names: PKS2, A-RAF, ARAF1, RAFA1
ARAF Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 001645
UniProt: P10398
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW