IFRD1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106435
Article Name: IFRD1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106435
Supplier Catalog Number: orb2106435
Alternative Catalog Number: BYT-ORB2106435-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFRD1
Conjugation: FITC
Alternative Names: PC4, TIS7
IFRD1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 001541
UniProt: O00458
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL