MRPL58 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106438
Article Name: MRPL58 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106438
Supplier Catalog Number: orb2106438
Alternative Catalog Number: BYT-ORB2106438-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ICT1
Conjugation: FITC
Alternative Names: DS1, DS-1, ICT1, MRP-L58
MRPL58 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 001536
UniProt: Q14197
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM