GCLC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106451
Article Name: GCLC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106451
Supplier Catalog Number: orb2106451
Alternative Catalog Number: BYT-ORB2106451-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GCLC
Conjugation: Biotin
Alternative Names: GCL, GCS, GLCL, GLCLC
GCLC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 001489
UniProt: P48506
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN