UBE4B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106481
Article Name: UBE4B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106481
Supplier Catalog Number: orb2106481
Alternative Catalog Number: BYT-ORB2106481-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UBE4B
Conjugation: Biotin
Alternative Names: E4, UFD2, HDNB1, UBOX3, UFD2A
UBE4B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 146kDa
NCBI: 001099032
UniProt: O95155
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL