TMEM184A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106517
Article Name: TMEM184A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106517
Supplier Catalog Number: orb2106517
Alternative Catalog Number: BYT-ORB2106517-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM184A
Conjugation: Biotin
Alternative Names: SDMG1
TMEM184A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 001091089
UniProt: Q6ZMB5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT