ACADVL Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106594
Article Name: ACADVL Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106594
Supplier Catalog Number: orb2106594
Alternative Catalog Number: BYT-ORB2106594-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACADVL
Conjugation: FITC
Alternative Names: ACAD6, LCACD, VLCAD
ACADVL Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 001029031
UniProt: P49748
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ