ACADVL Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2106596
Article Name: ACADVL Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106596
Supplier Catalog Number: orb2106596
Alternative Catalog Number: BYT-ORB2106596-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL
Conjugation: HRP
Alternative Names: ACAD6, LCACD, VLCAD
ACADVL Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 001029031
UniProt: P49748
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV