C12orf40 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2106614
Article Name: C12orf40 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106614
Supplier Catalog Number: orb2106614
Alternative Catalog Number: BYT-ORB2106614-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf40
Conjugation: HRP
Alternative Names: HEL-206, HEL-S-94
C12orf40 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 74kDa
NCBI: 001026918
UniProt: Q86WS4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN