KCTD21 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2106626
Article Name: KCTD21 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106626
Supplier Catalog Number: orb2106626
Alternative Catalog Number: BYT-ORB2106626-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCTD21
Conjugation: HRP
Alternative Names: KCASH2
KCTD21 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 001025030
UniProt: Q4G0X4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV