KCTD21 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106627
Article Name: KCTD21 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106627
Supplier Catalog Number: orb2106627
Alternative Catalog Number: BYT-ORB2106627-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCTD21
Conjugation: FITC
Alternative Names: KCASH2
KCTD21 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 001025030
UniProt: Q4G0X4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV