ARFIP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2106641
Article Name: ARFIP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106641
Supplier Catalog Number: orb2106641
Alternative Catalog Number: BYT-ORB2106641-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARFIP1
Conjugation: HRP
Alternative Names: HSU52521
ARFIP1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 001020766
UniProt: P53367
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: NKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWL