SH3KBP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2106654
| Article Name: |
SH3KBP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2106654 |
| Supplier Catalog Number: |
orb2106654 |
| Alternative Catalog Number: |
BYT-ORB2106654-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SH3KBP1 |
| Conjugation: |
FITC |
| Alternative Names: |
HSB1, AGMX2, CIN85, GIG10, HSB-1, IMD61, MIG18, CD2BP3 |
| SH3KBP1 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
68 |
| NCBI: |
001019837 |
| UniProt: |
Q5JPT5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS |
