HMBS Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106660
Article Name: HMBS Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106660
Supplier Catalog Number: orb2106660
Alternative Catalog Number: BYT-ORB2106660-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMBS
Conjugation: FITC
Alternative Names: UPS, PBGD, PORC, PBG-D
HMBS Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 001019553
UniProt: P08397
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA