C6orf173 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106715
Article Name: C6orf173 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106715
Supplier Catalog Number: orb2106715
Alternative Catalog Number: BYT-ORB2106715-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf173
Conjugation: Biotin
Alternative Names: CUG2, CENP-W, C6orf173
C6orf173 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 001012525
UniProt: Q5EE01
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV