C10orf132 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106727
Article Name: C10orf132 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106727
Supplier Catalog Number: orb2106727
Alternative Catalog Number: BYT-ORB2106727-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf132
Conjugation: Biotin
Alternative Names: C10orf132, C10orf133, bA459F3.4, bA451M19.3
C10orf132 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 001010917
UniProt: Q2TAP0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ