Tagln3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2106748
| Article Name: |
Tagln3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2106748 |
| Supplier Catalog Number: |
orb2106748 |
| Alternative Catalog Number: |
BYT-ORB2106748-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Biotin |
| Alternative Names: |
Np, Np25, AI426007, 2700038H05Rik, 2900005O10Rik |
| Tagln3 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
22kDa |
| NCBI: |
062728 |
| UniProt: |
Q9R1Q8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: WLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYG |
