MGC87631 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106769
Article Name: MGC87631 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106769
Supplier Catalog Number: orb2106769
Alternative Catalog Number: BYT-ORB2106769-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC87631
Conjugation: Biotin
MGC87631 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 24
NCBI: 001004306
UniProt: Q6NUI1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTV