AGBL5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107216
Article Name: AGBL5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107216
Supplier Catalog Number: orb2107216
Alternative Catalog Number: BYT-ORB2107216-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AGBL5
Conjugation: Biotin
Alternative Names: CCP5, RP75
AGBL5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 00650
UniProt: Q8NDL9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS