TSKS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107222
Article Name: TSKS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107222
Supplier Catalog Number: orb2107222
Alternative Catalog Number: BYT-ORB2107222-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSKS
Conjugation: Biotin
Alternative Names: TSKS1, TSSKS, STK22S1, PPP1R161
TSKS Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 068379
UniProt: Q9UJT2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERS