SPAG11B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107291
Article Name: SPAG11B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107291
Supplier Catalog Number: orb2107291
Alternative Catalog Number: BYT-ORB2107291-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPAG11B
Conjugation: Biotin
Alternative Names: EP2, HE2, EP2C, EP2D, HE2C, EDDM2B, SPAG11, SPAG11A
SPAG11B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 478114
UniProt: Q08648
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLP