SAMD4A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107312
Article Name: SAMD4A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107312
Supplier Catalog Number: orb2107312
Alternative Catalog Number: BYT-ORB2107312-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAMD4A
Conjugation: Biotin
Alternative Names: SMG, SMGA, SAMD4, SMAUG, SMAUG1
SAMD4A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 056404
UniProt: Q9UPU9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK