ACTL7B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107384
Article Name: ACTL7B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107384
Supplier Catalog Number: orb2107384
Alternative Catalog Number: BYT-ORB2107384-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACTL7B
Conjugation: Biotin
Alternative Names: Tact1
ACTL7B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 006677
UniProt: Q9Y614
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA