NUP155 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107462
Article Name: NUP155 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107462
Supplier Catalog Number: orb2107462
Alternative Catalog Number: BYT-ORB2107462-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUP155
Conjugation: Biotin
Alternative Names: N155, ATFB15
NUP155 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 147kDa
NCBI: 004289
UniProt: O75694
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY