TUBA3E Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2107643
Article Name: TUBA3E Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107643
Supplier Catalog Number: orb2107643
Alternative Catalog Number: BYT-ORB2107643-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBA3E
Conjugation: HRP
TUBA3E Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 997195
UniProt: Q6PEY2
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVD