TUBA3E Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2107644
Article Name: TUBA3E Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107644
Supplier Catalog Number: orb2107644
Alternative Catalog Number: BYT-ORB2107644-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBA3E
Conjugation: FITC
TUBA3E Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 997195
UniProt: Q6PEY2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVD