ENSA Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2107646
Article Name: ENSA Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107646
Supplier Catalog Number: orb2107646
Alternative Catalog Number: BYT-ORB2107646-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENSA
Conjugation: HRP
Alternative Names: ARPP-19e
ENSA Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 12
NCBI: 996930
UniProt: O43768
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL