C1orf102 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107654
Article Name: C1orf102 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107654
Supplier Catalog Number: orb2107654
Alternative Catalog Number: BYT-ORB2107654-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf102
Conjugation: Biotin
Alternative Names: NOR1, C1orf102
C1orf102 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 659484
UniProt: Q8WVF1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN