FAM47A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107669
Article Name: FAM47A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107669
Supplier Catalog Number: orb2107669
Alternative Catalog Number: BYT-ORB2107669-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FA47A
Conjugation: Biotin
FAM47A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 87kDa
NCBI: 981953
UniProt: Q5JRC9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RQLLKLDSERKLEDARAPCEGREKTTDEPTEPGKYPCGKFCPRPFETPLS